DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and ctrb.2

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:279 Identity:62/279 - (22%)
Similarity:102/279 - (36%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVLSL--TFSVCEKNKLSPRITG------GYRAKPYTIIYLVGIVYAKSPLSSLKFGA 57
            |..|..||.|:|  |...|....:.|.|||      |..|.|::..:.|.:    ...:...|..
Zfish     1 MAFVWILLCLALIGTAYGCGVPAIPPVITGYARIVNGEEAVPHSWPWQVSL----QDSTGFHFCG 61

  Fly    58 GTIISNQWILTVKEVLIFKYIEAHFG---SKRAFWG-YD------------ILRIYRE-NFYFHY 105
            |::|:..|::|.          ||..   |.|...| :|            :.::::. ||....
Zfish    62 GSLINEWWVVTA----------AHCNVRTSHRVILGEHDRSSNAESIQTMTVGKVFKHPNFNMFT 116

  Fly   106 DKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMV-CGWGTDKRKV-RLPTWMRCVEV 168
            ....|:.:......|.:..:|.|   ......:.:.|.|..| .|||..|... ..|..::...:
Zfish   117 INNDILLIKLATPAKINTHVSPV---CLAETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAAL 178

  Fly   169 EVMNNTECAKYHTPLKW------YEMCTSGEGFKGVCEGDMGGAVVTMGPNP-TFIGIIWLMPTN 226
            .::.|.:|.::     |      ..:|....|... |.||.||.:|...... |.:||:....:.
Zfish   179 PLLTNEDCKRF-----WGNKITDLMVCAGASGASS-CMGDSGGPLVCQKDGVWTLVGIVSWGSSV 237

  Fly   227 CSIGYPSVHIRVSDHIKWI 245
            ||...|.|:.||:....|:
Zfish   238 CSPSSPGVYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 52/251 (21%)
Tryp_SPc 26..248 CDD:304450 53/252 (21%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 49/245 (20%)
Tryp_SPc 34..259 CDD:238113 50/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.