DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG18754

DIOPT Version :10

Sequence 1:NP_729256.2 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:148 Identity:34/148 - (22%)
Similarity:52/148 - (35%) Gaps:33/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DRRMSRVRVPAYGARFERYVGNMTMVC----------------GWGTDKRKVRLPTWMRCVEVEV 170
            |..:.|::.|.      ||...:..:|                ||...|....|.|    ..|:.
  Fly   199 DIALLRLQFPV------RYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLIT----STVKE 253

  Fly   171 MNNTECA-KYHTPLKWYEMCTSGEGFKGVCEGDMGGAVV-TMGPN-PTFI---GIIWLMPTNC-S 228
            .|..:|. :|.:.....::|..|:.....|.|..|..|: .||.. ..|:   ||.......| |
  Fly   254 RNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYS 318

  Fly   229 IGYPSVHIRVSDHIKWIK 246
            .|.|.|:.::....:|||
  Fly   319 AGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_729256.2 Tryp_SPc 25..245 CDD:473915 31/145 (21%)
CG18754NP_652652.3 CLIP 36..84 CDD:463440
Tryp_SPc 108..338 CDD:238113 34/148 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.