DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG34409

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:269 Identity:58/269 - (21%)
Similarity:96/269 - (35%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-AGTIISNQWILTVKEVLI-----FKYIEAHFG 83
            |:.||.:|......:|..|.|.....|.:.|. :|::||:..|:|....::     .:......|
  Fly   249 RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLG 313

  Fly    84 SKRAFWGYDILRIYRENFYFH--YDKTRIIALVKCPYQKFDRRMSRVRVPAYGARF--------- 137
            |:.....:.|     |....|  ||:           .|:...::.:|:.:....|         
  Fly   314 SQDGATPFAI-----EQVIVHPNYDQ-----------PKYANDIALLRINSTNGTFTPICLPFNG 362

  Fly   138 -----ERYVGNMTMVCGW---GTDKRKVRLPT----WMRCVEVEVMNNTECAKYHTPLKW----- 185
                 .|.:|.:.:..||   .|:......|:    .:|.:.:.::|.|.||..:..|..     
  Fly   363 PITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQP 427

  Fly   186 -----YEMCTSGEGFKGVCEGDMGGAVVTMGPNPTF--------IGIIWLMPTNCSI-GYPSVHI 236
                 ..:|..|.....||.||.||..:..|.:..|        |||:...||.|.: ..|.|:.
  Fly   428 IVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYT 492

  Fly   237 RVSDHIKWI 245
            .||....||
  Fly   493 LVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 56/267 (21%)
Tryp_SPc 26..248 CDD:304450 57/268 (21%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 56/267 (21%)
Tryp_SPc 252..501 CDD:238113 55/264 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.