DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and cela1.1

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:288 Identity:59/288 - (20%)
Similarity:110/288 - (38%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVALLVLSLTFSV-------CEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTII 61
            ::.:|:||:..::       .|...:..|:.||..|||::..:.:.:.| :|......:..||:|
Zfish     1 MLRILLLSVLAAIGLTEPRYLEDLAIEERVIGGEIAKPHSWPWQISLQY-QSGGRYHHYCGGTLI 64

  Fly    62 SNQWILTVKEVLIFKYI----------------EAHFGSKRAF----WGYDILRIYRENFYFHYD 106
            ...|::.....:....|                |.:...|..|    |..:|:....:       
Zfish    65 RPGWVMVAAHCVDTSRIWSVALGDHDTTTHEGPEQYISVKGVFIHPNWNPNIVANGND------- 122

  Fly   107 KTRIIALVKCPYQKFDRRMSRVRV---PAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEV 168
                |||::.....  ...|.|:|   |:||....  .|:...:.|||..:....|...::...:
Zfish   123 ----IALLQLSINA--TLSSYVQVATLPSYGEILP--YGHTCYITGWGRTQTGGSLSAQLKQAYM 179

  Fly   169 EVMNNTECAK---YHTPLKWYEMCTSGEGFKGVCEGDMG--------GAVVTMGPNPTFIGIIWL 222
            .|:::..|::   :.:.:|...:|..|......|.||.|        |..|..|.. :|:.    
Zfish   180 PVVDHETCSQSDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVT-SFVA---- 239

  Fly   223 MPTNCSIGY--PSVHIRVSDHIKWIKHV 248
             .:.|:. |  |:|..|||.|:.|:.|:
Zfish   240 -SSGCNT-YKKPTVFTRVSYHVSWLNHI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/255 (21%)
Tryp_SPc 26..248 CDD:304450 53/257 (21%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 53/254 (21%)
Tryp_SPc 30..265 CDD:238113 53/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.