DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and ctrb.3

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:242 Identity:57/242 - (23%)
Similarity:96/242 - (39%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLI---FKYIEAHFGSKR 86
            ||..|..|.|::..:.|.:    ...:...|..|::|:..|::|.....:   .:.|.......:
Zfish    33 RIVNGEEAVPHSWPWQVSL----QDFTGFHFCGGSLINEFWVVTAAHCSVRTSHRVILGEHNKGK 93

  Fly    87 AFWGYDILRIYRENFYFH--YDKTRI---IALVK--CPYQKFDRRMSRVRVPAYGARFERYVGNM 144
            :....||..:.....:.|  |:...|   |||||  .| ...:..:|.|   ......:.:...|
Zfish    94 SNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAP-ASLNAHVSPV---CLAEASDNFASGM 154

  Fly   145 TMV-CGWG-TDKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWYE-----MCTSGEGFKGVCEGD 202
            |.| .||| |....:..|..::.|.:.:::|.:| |.|    |..     |..:|......|.||
Zfish   155 TCVTSGWGVTRYNALFTPDELQQVALPLLSNEDC-KNH----WGSNIRDTMICAGAAGASSCMGD 214

  Fly   203 MGGAVVTMGPNP-TFIGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248
            .||.:|....|. |.:||:....:.|....|.|:.||::...|:..:
Zfish   215 SGGPLVCQKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRDWVDQI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 56/237 (24%)
Tryp_SPc 26..248 CDD:304450 56/239 (23%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 56/237 (24%)
Tryp_SPc 34..261 CDD:238113 56/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.