DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:296 Identity:78/296 - (26%)
Similarity:133/296 - (44%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVV--ALLVLSLTFSVCEKNKLSP----------RITGGYRAKPYTIIYLVGIVYAKSPLSSL 53
            |||.|  ||.|.:.|.....:.||.|          |||.||.|....:.|:||::::.:     
  Fly     1 MKLFVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGN----- 60

  Fly    54 KFG----AGTIISNQWILTVKEVLIFKYIEAH-----------FGS------KRAFWGYDILRIY 97
              |    .|:||.|.|:||.          ||           :|:      :...|      :.
  Fly    61 --GNWWCGGSIIGNTWVLTA----------AHCTNGASGVTINYGASLRNQPQYTHW------VG 107

  Fly    98 RENF--YFHYDKTRI---IALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKV 157
            ..||  :.||:...:   |:|::.|:..|...:::|.:|:|..|::.|.|...:..|||......
  Fly   108 SGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGS 172

  Fly   158 RLPTWMRCVEVEVMNNTECAKYHTPLKW----YEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIG 218
            .||.|::.|:|::|:.::|::     .|    ..:|.:..|.|..|.||.||.:||...| ..:|
  Fly   173 PLPDWLQAVDVQIMSQSDCSR-----SWSLHDNMICINTNGGKSTCGGDSGGPLVTHEGN-RLVG 231

  Fly   219 II-WLMPTNCSIGYPSVHIRVSDHIKWIKHVSGVGF 253
            :. ::....|..|.|:|..||:.::.||:..:|:.:
  Fly   232 VTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 64/250 (26%)
Tryp_SPc 26..248 CDD:304450 65/252 (26%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 64/250 (26%)
Tryp_SPc 38..262 CDD:238113 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.