DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG9737

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:285 Identity:66/285 - (23%)
Similarity:108/285 - (37%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-AGTIISNQWILTVKEVLIFKYIEA 80
            |.| :::.||.||..|:.....:|..:||     :|..:| :|.:|.::.|||....:..:.:..
  Fly   142 CGK-QVTNRIYGGEIAELDEFPWLALLVY-----NSNDYGCSGALIDDRHILTAAHCVQGEGVRD 200

  Fly    81 HFGSKRAFWG---------------------------YDILRI---YRENFYFHYDKTRIIALVK 115
            ..|.|....|                           |:.:.:   |:|...:.|:...||.| |
  Fly   201 RQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRL-K 264

  Fly   116 CPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWG-TD-------------KRKVRLPTWMRCV 166
            .|. .|...:..:.:|..........|.|..|.||| ||             |.|:|:|      
  Fly   265 HPV-SFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIP------ 322

  Fly   167 EVEVMNNTECAK----YHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPT---FIGIIWLMP 224
               .::|..|.|    :...|...::|..||..|..|.||.||.::......:   ..|::....
  Fly   323 ---YVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGF 384

  Fly   225 TNCSI-GYPSVHIRVSDHIKWIKHV 248
            |.|.: |.|:|:..|:::..||..|
  Fly   385 TQCGMAGKPAVYTNVAEYTDWIDSV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 61/272 (22%)
Tryp_SPc 26..248 CDD:304450 62/274 (23%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 61/272 (22%)
Tryp_SPc 150..409 CDD:238113 62/274 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.