DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG11843

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:268 Identity:60/268 - (22%)
Similarity:99/268 - (36%) Gaps:68/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SPRITGGYRAKPYTIIYLVGIVYAKSPLSSLK-FGAGTIISNQWILTVK--------EVLIFKYI 78
            :|.|.||:.|:|....::..:.....|.|... |..|.:||.:::||..        ||.:.:..
  Fly    65 TPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLG 129

  Fly    79 EAHFGS------KRAFW--GYDILRIYRENFYFHYDKTRIIALVK--------------C-PYQK 120
            |..|.|      .|.:.  || |.....|:..|::|    |.|||              | |:| 
  Fly   130 ELDFDSLDEDAAPRDYMVAGY-IAHPGYEDPQFYHD----IGLVKLTEAVVFDLYKHPACLPFQ- 188

  Fly   121 FDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAKYHT---- 181
             |.|.|                :..:..|||:....::....:..|:::...|..|.|..|    
  Fly   189 -DERSS----------------DSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVE 236

  Fly   182 --PLKW---YEMCTSGEGFKGVCEGDMGGAVVTMGPN-PTFIGIIWLMPTNCSI---GYPSVHIR 237
              |..:   .::|...|..:..|.||.||.::..... |....::.:.....|.   |.|.::.|
  Fly   237 EFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTR 301

  Fly   238 VSDHIKWI 245
            |..::.||
  Fly   302 VYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 57/264 (22%)
Tryp_SPc 26..248 CDD:304450 59/265 (22%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 59/265 (22%)
Tryp_SPc 68..309 CDD:214473 57/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.