DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG11842

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:284 Identity:59/284 - (20%)
Similarity:98/284 - (34%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLSLTFSVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVL 73
            ::..|...|  ...:|.|.||..|.|....:...:.:.........|..||:||::.:||.    
  Fly    58 IIYKTLDKC--TSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTA---- 116

  Fly    74 IFKYIEAHFGSKRAFWGYDILRIYRENFYFH--------YDKTRIIALVKCPYQKFDRRMSRVRV 130
                ...|:..:.:   .:|.|:....|..:        :|.....|..:..|......:|.||:
  Fly   117 ----AHCHYSPQGS---VNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRL 174

  Fly   131 PAYGARFERY------------VGNMTMVCGWG-------TDKR---KVRLPTW-MRCVEVEVMN 172
             :....|..|            :|...:..|||       |:.:   ||:|..: .|| .:....
  Fly   175 -SRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRC-RITADR 237

  Fly   173 NTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTNC--------SI 229
            |.|..:.:....  ::|......|..|.||.||.|           :|:.|...|        ||
  Fly   238 NDELPEGYNATT--QLCIGSNEHKDTCNGDSGGPV-----------LIYHMDYPCMYHVMGITSI 289

  Fly   230 G-------YPSVHIRVSDHIKWIK 246
            |       .|:::.||..::.|||
  Fly   290 GVACDTPDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/265 (20%)
Tryp_SPc 26..248 CDD:304450 56/267 (21%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 56/267 (21%)
Tryp_SPc 73..312 CDD:214473 53/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.