DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG11841

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:285 Identity:68/285 - (23%)
Similarity:103/285 - (36%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TFSVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVK------- 70
            |...|..::  |.|..|..|:|....:...:.:.|:......|..||:|||:.:||..       
  Fly    61 TVDSCHGSR--PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEH 123

  Fly    71 -EVLIFKYIEAHFGSK--------------RAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQK 120
             ||.:.:..|..|.:.              :|..|::..::|.:           |.:|     :
  Fly   124 GEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYND-----------IGIV-----Q 172

  Fly   121 FDR--RMSRVRVPAY-----GARFERYVGNMTMVCGWGTDK---------RKVRLPTWM-RCVEV 168
            .||  :.:|.:.||.     |.:.|.::     ..|||..|         .||:|..:. |||. 
  Fly   173 LDREVKFNRYKHPACLPFDDGEQHESFI-----AIGWGQKKFAQKESKKLLKVQLQGYKDRCVS- 231

  Fly   169 EVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVV-----------TMGPNPTFIGIIWL 222
            .|..|.|....:.|..  ::|......|..|.||.||.|:           .||  .|..||   
  Fly   232 SVDANDELPNGYEPKS--QLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMG--ITSAGI--- 289

  Fly   223 MPTNCSI-GYPSVHIRVSDHIKWIK 246
               .||. ..||.:.||...:.|||
  Fly   290 ---TCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 62/270 (23%)
Tryp_SPc 26..248 CDD:304450 65/272 (24%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 63/270 (23%)
Tryp_SPc 72..310 CDD:214473 62/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.