DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG4815

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:306 Identity:62/306 - (20%)
Similarity:104/306 - (33%) Gaps:102/306 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVALLVLSLTFSVCEK--------NKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGT 59
            ||..||:|:   ||..:        .:..|||..|.:.   |:..|.|:       ....|....
  Fly     7 LVRLLLILN---SVRTEAGNREEWTGRFHPRIYNGIKT---TVESLGGV-------GIQLFNGRK 58

  Fly    60 IISNQWILTVKEVLIFKYIEAH------------FGSKRA--FW---GYDILRIYRENFYFHYDK 107
            ::.:..:||.:.:|    ..||            .|.|.|  .|   .::..::.|...:..|.|
  Fly    59 LVCSATLLTPRHIL----TAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAK 119

  Fly   108 TRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVG------------NMTMVCGWG------TDK 154
            .:.||.|.....|:..|             .:|:|            :..:..|||      .:.
  Fly   120 MKFIADVAVAKTKYPLR-------------SKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDES 171

  Fly   155 RKVRLPTWMRCVEVEVMNNTECAK-YHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIG 218
            ||    ...|.::|.:::..:|.| ....:....:|......|.:|.||.||        |..:|
  Fly   172 RK----KTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGG--------PLLLG 224

  Fly   219 IIWLMPTNCSIG----------YPSVHIRVSDHIKWIKH-VSGVGF 253
                 ...|.|.          .|.|::.|..:.|:||. ::.:||
  Fly   225 -----RQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTINRMGF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 50/265 (19%)
Tryp_SPc 26..248 CDD:304450 51/268 (19%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 46/250 (18%)
Trypsin 49..256 CDD:278516 44/247 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.