DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG5255

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:284 Identity:68/284 - (23%)
Similarity:111/284 - (39%) Gaps:67/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVALLVLSLTFSVCEKNKLSP------RITGGYRA----KPYTIIYLVGIVYAKSPLSSLKFGA 57
            :::.||.|.|..|......|.|      ||.||..|    .||.|           .|..:..||
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQI-----------SLQGIGSGA 54

  Fly    58 ----GTIISNQWILTV------KEVLIFKYI----EAHFGSKRAFWGYDIL-------RIYRENF 101
                |.||..:||:|.      ::...|:.:    :.|....:.::...|:       |.||.:.
  Fly    55 HSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDI 119

  Fly   102 -YFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYV-GNMTMVCGWGTDKRKVRLPTWMR 164
             ..|.:::.:          ||.....|.:.     .|..| |:..::.||||......:|..::
  Fly   120 ALLHLNESIV----------FDNATQPVELD-----HEALVPGSRLLLTGWGTLSLGGDVPARLQ 169

  Fly   165 CVEVEVMNNTECAKYH---TPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTN 226
            .:||..:...:|...|   |.:....:||..:..:|.|.||.||.:|..|.....:.  |.:|  
  Fly   170 SLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVN--WGLP-- 230

  Fly   227 CSIGYPSVHIRVSDHIKWIK-HVS 249
            |:.|||..|..:|.:..:|: |:|
  Fly   231 CAKGYPDAHASISYYHDFIRTHLS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 58/249 (23%)
Tryp_SPc 26..248 CDD:304450 58/252 (23%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 58/249 (23%)
Tryp_SPc 30..252 CDD:238113 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.