DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG4053

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:284 Identity:63/284 - (22%)
Similarity:107/284 - (37%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVALLVLSLTFSVC------EKNKLSPRITGGYRAKPYTIIYLVGI-VYAKSPLSSLKFGAGTII 61
            ::.||:|..:..|.      .:..|..||.||..|:.....|.|.| ...|:.:.|     |.|:
  Fly     7 LIWLLLLGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHICS-----GVIL 66

  Fly    62 SNQWILTVKEVLIFKYIEAHFGSKRAFWG---------------------YDILRIY-------- 97
            :.|||||.....:...||    ..|...|                     |||..:|        
  Fly    67 NEQWILTAGHCALDFSIE----DLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIH 127

  Fly    98 -RENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPT 161
             .|:..|: |:|:|:.|            ||.:.||         |:...:.|||..:.......
  Fly   128 VNESIIFN-DRTQIVEL------------SREQPPA---------GSTVTLTGWGAPESSYPTVQ 170

  Fly   162 WMRCVEVEVMNNTECAK---YHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WL 222
            :::.:.:.::.:.||.:   :|..:....:||.....:|.|.||.||.::..|   ..:|:: | 
  Fly   171 YLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEG---KLVGLVNW- 231

  Fly   223 MPTNCSIGYPSVHIRVSDHIKWIK 246
             ...|.:|.|.::.....:..||:
  Fly   232 -GRACGVGMPDMYANTVYYQDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 56/254 (22%)
Tryp_SPc 26..248 CDD:304450 57/256 (22%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 56/254 (22%)
Tryp_SPc 35..256 CDD:238113 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.