DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG17475

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:229 Identity:52/229 - (22%)
Similarity:85/229 - (37%) Gaps:69/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GTIISNQWILTVKEVLIFKYIEAHFGSKRAFWGYD--ILRIYRENFYFHYDKTRIIALVK----- 115
            |.||..:.:||.          ||     ..:||:  .||:....  ..|:|...:..|:     
  Fly    78 GCIIDERHVLTA----------AH-----CVYGYNPTYLRVITGT--VEYEKPDAVYFVEEHWIH 125

  Fly   116 CPYQK--FDRRMSRVRVPAYGARFERYV------------GNMTMVCGWGTDK---------RKV 157
            |.|..  :...::.:|:.. ..:|..|.            |...::.|||:.:         :|.
  Fly   126 CNYNSPDYHNDIALIRLND-TIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKA 189

  Fly   158 RLPTWMRCVEVEVMNNT----ECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIG 218
            .|...:.....|:|||.    .|          .:||...|.:|.|.||.||.:.   .|....|
  Fly   190 YLTHVVYSTCQEIMNNDPSNGPC----------HICTLTTGGQGACHGDSGGPLT---HNGVLYG 241

  Fly   219 II-WLMPTNCSIGYPSVHIRVSDHIKWIKH-VSG 250
            :: |..|  |::|.|..|..|..:::||:. :||
  Fly   242 LVNWGYP--CALGVPDSHANVYYYLEWIRSMISG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 48/221 (22%)
Tryp_SPc 26..248 CDD:304450 50/225 (22%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 48/221 (22%)
Tryp_SPc 50..269 CDD:238113 50/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.