Sequence 1: | NP_001303408.1 | Gene: | sphinx2 / 38833 | FlyBaseID: | FBgn0052382 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536776.2 | Gene: | modSP / 42032 | FlyBaseID: | FBgn0051217 | Length: | 628 | Species: | Drosophila melanogaster |
Alignment Length: | 244 | Identity: | 47/244 - (19%) |
---|---|---|---|
Similarity: | 88/244 - (36%) | Gaps: | 65/244 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 CEKN--KLSPRI----TGGYRAKPYTIIYLVGI-VYAKSPLSSLKFGAGTIISNQWILTVKEVLI 74
Fly 75 FKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQK-FDRRMSRVRVPAYGARFE 138
Fly 139 RYVGNMTM---------------VC---------------------GWGTDKRKVRLPTWMRCVE 167
Fly 168 VEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTF 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sphinx2 | NP_001303408.1 | Tryp_SPc | 25..245 | CDD:214473 | 44/234 (19%) |
Tryp_SPc | 26..248 | CDD:304450 | 44/233 (19%) | ||
modSP | NP_536776.2 | LDLa | 27..58 | CDD:197566 | |
LDLa | 70..101 | CDD:197566 | |||
LDLa | 123..157 | CDD:197566 | |||
LDLa | 167..199 | CDD:238060 | |||
CCP | <251..284 | CDD:153056 | |||
Sushi | 309..354 | CDD:278512 | 47/244 (19%) | ||
Tryp_SPc | 371..616 | CDD:214473 | 43/227 (19%) | ||
Tryp_SPc | 371..591 | CDD:304450 | 43/227 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45436884 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |