DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and modSP

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:244 Identity:47/244 - (19%)
Similarity:88/244 - (36%) Gaps:65/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEKN--KLSPRI----TGGYRAKPYTIIYLVGI-VYAKSPLSSLKFGAGTIISNQWILTVKEVLI 74
            ||::  :|:..|    :|||......:.:.||: |:........:.| |::::...::|....: 
  Fly   354 CEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCG-GSLLTPDLVITAAHCV- 416

  Fly    75 FKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQK-FDRRMSRVRVPAYGARFE 138
              |.|    ..|..:.||..|:....||.:|.:|       .|.:| .|.|:..: .|.|..|.|
  Fly   417 --YDE----GTRLPYSYDTFRVIAAKFYRNYGET-------TPEEKRRDVRLIEI-APGYKGRTE 467

  Fly   139 RYVGNMTM---------------VC---------------------GWGTDKRKVRLPTWMRCVE 167
            .|..::.:               :|                     ||..:.:..     ::.|.
  Fly   468 NYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHE-----LQFVP 527

  Fly   168 VEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTF 216
            ....:|:.|.:....::..:.|...:|....|:||.||...:..|...|
  Fly   528 AVSKSNSVCRRNLRDIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAF 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 44/234 (19%)
Tryp_SPc 26..248 CDD:304450 44/233 (19%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 47/244 (19%)
Tryp_SPc 371..616 CDD:214473 43/227 (19%)
Tryp_SPc 371..591 CDD:304450 43/227 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.