DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG8870

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:280 Identity:50/280 - (17%)
Similarity:94/280 - (33%) Gaps:104/280 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PYTIIYLVGIVYAKSPLSSL---KFGAGTIISNQWILTVKEVLIFKYIEAHFGSKRAFWGYDILR 95
            |:..:.|.|   .|:.||..   |.| |::|:|.::||....:.:.:::..:..|       .:|
  Fly    96 PWMAMLLYG---NKNNLSQKLVPKCG-GSLINNWYVLTAAHCVEYPFMDYPYALK-------TVR 149

  Fly    96 IYREN------------------FYFHYDKTRIIALVKCPYQKFDR--------RMSRVRVPAYG 134
            :...|                  .|...:..:||.     :::|:|        .:.|::.|.  
  Fly   150 LGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIIT-----HEQFNRGRRLINDIALVRLKFPV-- 207

  Fly   135 ARFERYVGNMTMVC-----GWGTDKRKVRLPTWM---RCVEVEVMNNTECAKYHTPLKWYEMCTS 191
                ||...:..:|     .....|||.:...|.   :.:..||:..:..|:.|.     ::|.|
  Fly   208 ----RYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHP-----DVCKS 263

  Fly   192 GEGF---KGVC----------EGDMGG-----------------AVVTMGPNPTFIGIIWLMPTN 226
            ...|   ..:|          .||.||                 .:::.|..|..:       ..
  Fly   264 NYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVL-------KT 321

  Fly   227 CSIGYPSVHIRVSDHIKWIK 246
            |.   |:.:.:.|...:|||
  Fly   322 CK---PAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 47/277 (17%)
Tryp_SPc 26..248 CDD:304450 50/280 (18%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 50/280 (18%)
Tryp_SPc 93..337 CDD:214473 47/277 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.