DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and snk

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:276 Identity:51/276 - (18%)
Similarity:98/276 - (35%) Gaps:78/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PRITGGYRAKPYTIIYLVGIVYAK---SPLSSLKFG-AGTIISNQWILTVKEVLIFKYIEAHFGS 84
            |.|.||...:.....::..:.:.:   |....:|:| .|.::|..::||....       |..||
  Fly   184 PLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHC-------ATSGS 241

  Fly    85 KRAFWGYDILRI-------------------------YRENFYFHYDKTRIIALVKCPYQ-KFDR 123
            |..    |::|:                         ||.:.|:|     .|||:|...: ||..
  Fly   242 KPP----DMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYH-----DIALLKLTRRVKFSE 297

  Fly   124 --------RMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAK-Y 179
                    ::..:::|.            .:..|||..:........:|.|:::|:....|.: |
  Fly   298 QVRPACLWQLPELQIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIY 350

  Fly   180 HTPLKWYEMCTSGE-------GFKGVCEGDMGGAVVTMGPN----PTFIGIIWLMPTNCSIGYPS 233
            ....:.......|:       |.:..|:||.||.:..:.|.    ...:||........:...|.
  Fly   351 RKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPG 415

  Fly   234 VHIRVSDHIKWIKHVS 249
            |:.|:..::.||:.::
  Fly   416 VYTRLYSYLDWIEKIA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 48/269 (18%)
Tryp_SPc 26..248 CDD:304450 50/271 (18%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 50/271 (18%)
Tryp_SPc 186..427 CDD:214473 48/268 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.