DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and MP1

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:290 Identity:64/290 - (22%)
Similarity:110/290 - (37%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLIFKYIEAH 81
            |.:| ...|:.||.........::..|.|.|..........|::|:::::||.          ||
  Fly   130 CGEN-FGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTA----------AH 183

  Fly    82 -----------FGSKRAFW----------GYDILRIYRENFYFHY----------------DKTR 109
                       .|.:...|          |.:..|...|. |..|                |:..
  Fly   184 CVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEP-YVDYPVEERIPHPQYPGNSRDQLN 247

  Fly   110 IIALVK----CPYQKFDRRMSRVRVPAYGARFER-YVGNMTMVCGWG------TDKRKVRLPTWM 163
            .|||::    ..|..|   :..|.:|...::... ::|...:|.|||      |...|::     
  Fly   248 DIALLRLRDEVQYSDF---ILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK----- 304

  Fly   164 RCVEVEVMNNTEC-AKYHTPLKWY---EMCTSG-EGFKGVCEGDMGGAVV----TMGPNPTFI-G 218
              .|::.:..:|| .:|.|..:..   :||..| ||... |.||.||.::    :.|.:..:| |
  Fly   305 --AELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDS-CRGDSGGPLLLEDYSNGNSNYYIAG 366

  Fly   219 IIWLMPTNCSI-GYPSVHIRVSDHIKWIKH 247
            ::...||.|.: |:|.|:.||..::.||::
  Fly   367 VVSYGPTPCGLKGWPGVYTRVEAYLNWIEN 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 60/278 (22%)
Tryp_SPc 26..248 CDD:304450 61/281 (22%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 60/278 (22%)
Tryp_SPc 138..397 CDD:238113 61/281 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.