DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG14088

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:296 Identity:68/296 - (22%)
Similarity:103/296 - (34%) Gaps:102/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVALLVLSLTF-----------SVC--EKNKLSPRITGGYRAKPYT-IIYLVGIVYAKSPLSSLK 54
            :||:|...|.|           ::|  .::.|||.|.|     |:| |::..|.:          
  Fly     7 IVAVLTSLLIFLSGTGSAQFLGNICGERRDGLSPDIVG-----PWTAILHHFGRI---------- 56

  Fly    55 FGAGTIISNQWILT--------------------VKEVLIFKYIEAHFGSKRAF------WGYDI 93
            .|.||:|..::|||                    :...|...:|.|.|.|...|      ....:
  Fly    57 VGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGL 121

  Fly    94 LRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGW-GTDKR-K 156
            :::.|...|    |..||.:  |..  .|.||.     .:....:.:.|..     | .:||. .
  Fly   122 MKLLRTVVY----KEHIIPV--CIL--MDSRMQ-----TFADELDYFNGTT-----WKNSDKSPM 168

  Fly   157 VRLPTWMRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGV--CEGDMGGAVVT----MGPNPT 215
            :|..|.:|..:.       |.|    |...:.|.   |.|.:  |:...|.|:..    :|||.|
  Fly   169 LRSKTVIRMPQA-------CGK----LDHGQFCA---GHKDLDSCDEPSGAALTREIDYIGPNRT 219

  Fly   216 FI-GIIWLMPTNCSIG--YPSVHIRVSDHIKWIKHV 248
            .: ||...:...||..  |..|   |..| :||..|
  Fly   220 VLFGIANSVEVKCSNSRTYTDV---VQLH-QWISMV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 56/257 (22%)
Tryp_SPc 26..248 CDD:304450 58/259 (22%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 58/259 (22%)
Tryp_SPc 42..248 CDD:214473 56/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.