DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG11529

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:238 Identity:60/238 - (25%)
Similarity:103/238 - (43%) Gaps:40/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLI-FKYIEAHFGSK-----RAFWGYD 92
            ||.::.:...::.|..|.     .||::..:||||.....: ..:.:.:.|:|     ....|. 
  Fly    42 PYQVMLIGKQLWRKRILC-----GGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGL- 100

  Fly    93 ILRIYRENFYFHYDK------TRIIALVKCPYQ-KFDRRMSRVRVPA-YGARFERYVGNMTMVCG 149
               :.|.|.:..:::      ...|||||.|.. .|..|:....:|: |  |.:::.|...:..|
  Fly   101 ---VLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRY--RHDQFAGMSVVASG 160

  Fly   150 WGTDKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWYEMCTSG----EGFKG--VCEGDMGGAVV 208
            ||.........: |:..|::|::|.|||:.      |::.|||    :|.|.  ||.||.||.:|
  Fly   161 WGAMVEMTNSDS-MQYTELKVISNAECAQE------YDVVTSGVICAKGLKDETVCTGDSGGPLV 218

  Fly   209 TMGPNPTFIGIIWLMPTN-CSIGYPSVHIRVSDHIKWIKHVSG 250
             :......:||....|.: |....|....||:.::.||:...|
  Fly   219 -LKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 57/231 (25%)
Tryp_SPc 26..248 CDD:304450 59/234 (25%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 59/234 (25%)
Tryp_SPc 37..255 CDD:214473 57/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.