DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG18179

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:138/276 - (50%) Gaps:31/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVLSLTFSVC------EKNKLSP----------RITGGYRAKPYTIIYLVGIVYAKSP 49
            |||.  ||.||:..:|.      .:..|.|          ||..||.|......|:||::.....
  Fly     1 MKLF--LLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDG 63

  Fly    50 LSSLKFGAGTIISNQWILTVKEVLIFKYIEAHFGSKRAFWGYD-ILR--IYRENFYFH----YDK 107
            .:|...||||||::.||||....|...|:|.|:||.   ||:: ..|  :.|:||..|    .:.
  Fly    64 SNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSN---WGWNGAFRQSVRRDNFISHPNWPAEG 125

  Fly   108 TRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMN 172
            .|.|.|::.|...|...:::|.:|::....:|:|....:.|||| ......|..|::|::|::::
  Fly   126 GRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWG-GMDNGNLADWLQCMDVQIIS 189

  Fly   173 NTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTNCSIGYPSVHIR 237
            |:||.:.:..:...:|||.....|..|.||.||.:|| ..|...:|:|.....:|..| ||.:.|
  Fly   190 NSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVT-HDNARLVGVITFGSVDCHSG-PSGYTR 252

  Fly   238 VSDHIKWIKHVSGVGF 253
            |:|::.||:..:|:.:
  Fly   253 VTDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 73/226 (32%)
Tryp_SPc 26..248 CDD:304450 74/228 (32%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/226 (32%)
Tryp_SPc 40..263 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.