DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:280 Identity:75/280 - (26%)
Similarity:129/280 - (46%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVLSL------TFSVCEKNKLSP--------RITGGYRAKPYTIIYLVGIVYAKSPLS 51
            ||..:|:|.|::      |.......||:|        |||.||.|:.....|.||:.:     |
  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF-----S 60

  Fly    52 SLKFGAGTIISNQWILTVKEVL-----IFKYIEAHFGSKRAF--WGYDILRIYRENFYFHYDKTR 109
            ...:..|:||::.|:||.:..:     :..|..|.:.:...|  |      :...||..|  .:.
  Fly    61 GGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHW------VGNGNFIKH--SSA 117

  Fly   110 IIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNT 174
            .|||::.|:..|...:::|.:|:|..|:..|.....:.||||.......||.:::||::::::|:
  Fly   118 DIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNS 182

  Fly   175 ECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTN------CSIGYPS 233
            ||:.|:..:....:|......|..|.||.||.:|| ......:|:     ||      |..|.|:
  Fly   183 ECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVT-HDGTKLVGV-----TNFGSVAGCQSGAPA 241

  Fly   234 VHIRVSDHIKWIKHVSGVGF 253
            ...||:.|:.||:..:|:.:
  Fly   242 GFQRVTYHLDWIRDHTGIAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 63/232 (27%)
Tryp_SPc 26..248 CDD:304450 64/234 (27%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/232 (27%)
Tryp_SPc 40..256 CDD:238113 64/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.