DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:279 Identity:75/279 - (26%)
Similarity:132/279 - (47%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVLSLTFSVCEKN-----------KLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLK 54
            ||:.:.:|.|::..:...::           |:..|||.||.|:.....|.||:.:     |...
  Fly     1 MKVFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF-----SGGW 60

  Fly    55 FGAGTIISNQWILTVKEVLIFKYIEAHFG------SKRAFWGYDILRIYRENFYFHYDKTRIIAL 113
            :..|:||||:|:||.:..:....:..:||      ::...|      :...||..|  .:..|||
  Fly    61 WCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHW------VGSGNFITH--GSADIAL 117

  Fly   114 VKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAK 178
            ::.|:..|...:::|.:|:|..|:..|.....:.||||.......||.:::||::::::|:|||.
  Fly   118 IRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECAS 182

  Fly   179 YHTPLKWYEMCTSGEGF--------KGVCEGDMGGAVVTMGPNPTFIGII-WLMPTNCSIGYPSV 234
            |      |...|.|:..        ||.|.||.||.:|| ......:|:. |:....|..|:|:.
  Fly   183 Y------YGTGTVGDNIICVRVVDGKGTCGGDSGGPLVT-HDGSKLVGVTNWVSGAGCQAGHPAG 240

  Fly   235 HIRVSDHIKWIKHVSGVGF 253
            ..||:.|:.||:..:|:.:
  Fly   241 FQRVTYHLDWIRDHTGIAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 67/234 (29%)
Tryp_SPc 26..248 CDD:304450 68/236 (29%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 67/234 (29%)
Tryp_SPc 37..254 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.