DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG10472

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:262 Identity:72/262 - (27%)
Similarity:111/262 - (42%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGA----GTIISNQWILTVKEVL------IFKY 77
            |.|||||..|:|....|.||:      |..:..||    |||||::||:|.....      :..|
  Fly    44 SGRITGGQIAEPNQFPYQVGL------LLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVY 102

  Fly    78 IEAHFGSKRAFWGYDILRIYRENFYFHYD-----KTRIIALVKCPYQ-KFDRRMSRVRVPAYGAR 136
            :.||..:.....|..|:.:..:|...|.|     .|..|:|:|.|.. :|::.:...::|.....
  Fly   103 LGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDS 167

  Fly   137 FERYVGNMTMVCGWG---------TDKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWY------ 186
            :..|.|...:..|||         ||        .::...|.:|||:.|:      .||      
  Fly   168 YSTYGGENAIASGWGKISDSATGATD--------ILQYATVPIMNNSGCS------PWYFGLVAA 218

  Fly   187 -EMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMPTNCSIGYPSVHIRVSDHIKWIKHVS 249
             .:|....|....|.||.||.:|....:.|.||.. :.:...|.:|:|.|..|::.::.||:..|
  Fly   219 SNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKS 283

  Fly   250 GV 251
            ||
  Fly   284 GV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 66/252 (26%)
Tryp_SPc 26..248 CDD:304450 67/254 (26%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 66/252 (26%)
Tryp_SPc 47..282 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.