DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:287 Identity:76/287 - (26%)
Similarity:123/287 - (42%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVALLVLSLTFSVCE---KNKLSP-------RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGA 57
            :::||.|.:..|...|   :::..|       |||||..|......|.||:....|.|||...| 
  Fly     5 IILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCG- 68

  Fly    58 GTIISNQWILT-------VKEVLIF-----------------KYIEAHFGSKRAFWGYDILRIYR 98
            |::|.:.|:||       |:.|.::                 ..|..|.|     |....||   
  Fly    69 GSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSG-----WNSANLR--- 125

  Fly    99 ENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWG-TDKRKVRLPTW 162
                      ..|:|:|.|......|:|.|::|:....:..:||::.:..||| |......:.|.
  Fly   126 ----------NDISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATN 180

  Fly   163 MRCVEVEVMNNTECAK-YHTPLKW-YEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMP 224
            ::.|::.|:.||:||: |.|.:.. ..:|.:....|..|.||.||.:|....:.. ||:. :...
  Fly   181 LQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQ-IGLTSFGAS 244

  Fly   225 TNCSIGYPSVHIRVSDHIKWIKHVSGV 251
            ..|..|||:...||:.::.|||..:|:
  Fly   245 AGCEKGYPAAFTRVTSYLDWIKTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 66/247 (27%)
Tryp_SPc 26..248 CDD:304450 68/249 (27%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 66/247 (27%)
Tryp_SPc 38..268 CDD:238113 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.