DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG6462

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:269 Identity:69/269 - (25%)
Similarity:114/269 - (42%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEKNKLS--------PRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVL 73
            |||.::.        .||.||..|......|.||:|...|....:|.| |::|:.|::||....|
  Fly    60 CEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCG-GSLITLQFVLTAAHCL 123

  Fly    74 -------------IFKYIEAHFGSKRAFWGYDILRIYRENF-----YFHYDKTRIIALVKCPYQK 120
                         :|..:|.         ..:.|::...:|     |..:.....:||::.|.:.
  Fly   124 TDAIAAKIYTGATVFADVED---------SVEELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKV 179

  Fly   121 FDRRMSRVRVPAYGARFER---YVGNMTMVCGWG-----TDKRKVRLPTWMRCVEVEVMNNTECA 177
              |...:|:.......|..   .||.:..:.|||     |||| .||   ::.::.||::...|.
  Fly   180 --RTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKR-TRL---LQYLDAEVIDQERCI 238

  Fly   178 KYHTP---LKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTF-IGII-WLMPTNCSIGYPSVHIR 237
            .|..|   .:...:||.|...:|.|.||.||.||....|.:: ||:. :.....|.:|.|:|:.|
  Fly   239 CYFLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTR 303

  Fly   238 VSDHIKWIK 246
            ::.::.||:
  Fly   304 ITAYLPWIR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 64/250 (26%)
Tryp_SPc 26..248 CDD:304450 65/252 (26%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 64/250 (26%)
Tryp_SPc 77..314 CDD:238113 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.