DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG10477

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:283 Identity:72/283 - (25%)
Similarity:120/283 - (42%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVALLVLSL-TFSVCEKNKLSP--------------RITGGYRAKPYTIIYLVGIVYAKSPLSSL 53
            |.|:|||:: |.|.....:.:|              |||.|.:|......|.||:.: ||...|.
  Fly     3 VFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSF-KSSAGSW 66

  Fly    54 KFGAGTIISNQWILTVKEVLIFKYIEAH----FGSKRAFWGYDI-------LRIYRENFYFH--Y 105
            ..| |:||:|.|:||.          ||    ..|...::|..:       .::....|..|  |
  Fly    67 WCG-GSIIANTWVLTA----------AHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGY 120

  Fly   106 DKTRI---IALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWG-TDKRKVRLPTWMRCV 166
            :...:   |:|:|.|...|...::::.:||..:.:..|.|...:..||| |....:.:.|.::..
  Fly   121 NAATLRNDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYA 185

  Fly   167 EVEVMNNTECAKY--HTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMPTNCS 228
            :.:|:.|..|.|.  .:.:....:|......|..|:||.||.:..   |...||:. ::....|.
  Fly   186 QFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL---NNRLIGVTSFVSSKGCE 247

  Fly   229 IGYPSVHIRVSDHIKWIKHVSGV 251
            ...|:...||:.::.|||:.|||
  Fly   248 KNAPAGFTRVTSYLDWIKNQSGV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 58/239 (24%)
Tryp_SPc 26..248 CDD:304450 60/241 (25%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 58/239 (24%)
Tryp_SPc 40..267 CDD:238113 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.