DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG13527

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:285 Identity:67/285 - (23%)
Similarity:111/285 - (38%) Gaps:66/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVALLVLSLTFSVCEKNKLSPRITGGYR---AKPYTIIYLVGIVYAKSPLSSLKFG-----AGT 59
            |:..:::||....:  |...||:..|...   ||     |:|.|   :|...:..||     .|.
  Fly    11 LITVMVILSGAHRM--KRLSSPKFHGDETLELAK-----YVVSI---RSRTPNKYFGDNHYCGGG 65

  Fly    60 IISNQWILTVKEVLIFKYIEAHFGSK---RAFW---------------GYDIL----RIY-RENF 101
            ::||||::|....::.:       ||   :|.|               |..:.    .:| .:||
  Fly    66 LLSNQWVITAAHCVMGQ-------SKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF 123

  Fly   102 YFHYDKTRIIALVKCPYQKF---DRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWM 163
            ..|  .|..:||:|. .:|.   |.|:..:.:|....:    :|....|.|||.......|...:
  Fly   124 TMH--NTFNMALMKL-QEKMPSNDPRIGFLHLPKEAPK----IGIRHTVLGWGRMYFGGPLAVHI 181

  Fly   164 RCVEVEVMNNTECAKYHTPLKWYEMCTSGEGF---KGVCEGDMGGAVVTMGPNPTFIGIIWLMPT 225
            ..|:|.:|:|..|..|........||.....:   ...|.||:|..:::   ....:||: ..|.
  Fly   182 YQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLS---GKVVVGIV-AYPI 242

  Fly   226 NCS-IGYPSVHIRVSDHIKWIKHVS 249
            .|. ...|||:..|...::||:|.:
  Fly   243 GCGCTNIPSVYTDVFSGLRWIRHTA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 58/257 (23%)
Tryp_SPc 26..248 CDD:304450 60/259 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 57/243 (23%)
Tryp_SPc 43..263 CDD:214473 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.