DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG17572

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:104/279 - (37%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLIFKYIEA 80
            ||.|:.:......|..:.|:  :..:|..:..:...:... ||.:|:.:.|||.....:.| .:.
  Fly   123 VCGKSLVQGHFYKGLGSYPF--VARIGFKHVNTGAFAYPC-AGAVIARRVILTAAHCALAK-ADG 183

  Fly    81 HFGSKRAFWGYD---------------------ILRI-----YRENFYFHYDKTRIIAL--VKCP 117
            |..|......||                     |..:     |::..| |:|    |||  :|.|
  Fly   184 HRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQY-HHD----IALLVLKTP 243

  Fly   118 YQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWG-TDKRKVRLP----------TWMRCVE---- 167
               .:..::...:.....|....||....:.||| .....||.|          :|..|:.    
  Fly   244 ---LNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGS 305

  Fly   168 ---VEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTF--IGIIWLMPTNC 227
               :|..|:.|.       :|  ||..||| |.||:| .|||.:.:..|..|  |||:.....||
  Fly   306 TGALESPNSIEG-------QW--MCAGGEG-KDVCQG-FGGAPLFIQENGIFSQIGIMSFGSDNC 359

  Fly   228 -SIGYPSVHIRVSDHIKWI 245
             .:..|||:..|:...:||
  Fly   360 GGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 62/268 (23%)
Tryp_SPc 26..248 CDD:304450 64/269 (24%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 63/264 (24%)
Tryp_SPc 138..378 CDD:214473 61/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.