DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and psh

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:306 Identity:54/306 - (17%)
Similarity:100/306 - (32%) Gaps:113/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SVCEK----------NKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-----AGTIISNQ 64
            :.|:|          |:|...|.|||...|....::..|.|       :.||     .|::|:::
  Fly   123 AACKKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGY-------ITFGTDFRCGGSLIASR 180

  Fly    65 WILTVKEVLIFKYIEAHF----GSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRM 125
            ::||.          ||.    .:..||.....:.|...:   |..:..:|..||...|....:.
  Fly   181 FVLTA----------AHCVNTDANTPAFVRLGAVNIENPD---HSYQDIVIRSVKIHPQYVGNKY 232

  Fly   126 SRVRV------------------------PAYGARFERYVGNMTMVCGWGT------DKRKVRL- 159
            :.:.:                        |...::|        .|.|||.      .:.|:.| 
  Fly   233 NDIAILELERDVVETDNIRPACLHTDATDPPSNSKF--------FVAGWGVLNVTTRARSKILLR 289

  Fly   160 ------------------PTWMRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGA 206
                              |..:|.::..|:::..||            ...:.....|:||.||.
  Fly   290 AGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA------------IDQKLIADACKGDSGGP 342

  Fly   207 VV----TMGPNPTFIGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248
            ::    ......|.:|:| .....|:...|.::.|||.::.:|:.:
  Fly   343 LIHELNVEDGMYTIMGVI-SSGFGCATVTPGLYTRVSSYLDFIEGI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 49/281 (17%)
Tryp_SPc 26..248 CDD:304450 50/283 (18%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 49/281 (17%)
Tryp_SPc 144..387 CDD:238113 50/283 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.