DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and sphe

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:261 Identity:59/261 - (22%)
Similarity:102/261 - (39%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLVVALLVLSLTFSVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWI 66
            :||:..|:......:|.   ...||.||..|......:.     |...:.:.....|:|:|...|
  Fly     5 RLVILGLIGLTAVGMCH---AQGRIMGGEDADATATTFT-----ASLRVDNAHVCGGSILSQTKI 61

  Fly    67 LTVKEVL--IFKYIEA-----HFGSKRAFWGYDILRIYRENFYFH---YDKTRIIALVKCPYQ-K 120
            ||....:  ..|.|:|     ..||...:.|..|:.:  |:...|   |:....:|::....: .
  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNV--ESVAVHPDYYNLNNNLAVITLSSELT 124

  Fly   121 FDRRMSRVRVPAYGARFERYVGNMTMVCGW-----GTDKRKVRLPTWMRCVEVEVMNNTECAKYH 180
            :..|::.:.:.|.|..... .|:..:|.||     ||:..|:|.      :.::|.....|...:
  Fly   125 YTDRITAIPLVASGEALPA-EGSEVIVAGWGRTSDGTNSYKIRQ------ISLKVAPEATCLDAY 182

  Fly   181 TPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTNCSIGYPSVHIRVSDHIKWI 245
            :.......|.:.|..:|.|.||.||..:.   ..|.||:...:...|...||.|.:|:|.:..||
  Fly   183 SDHDEQSFCLAHELKEGTCHGDGGGGAIY---GNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

  Fly   246 K 246
            :
  Fly   245 Q 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/235 (23%)
Tryp_SPc 26..248 CDD:304450 54/237 (23%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 49/216 (23%)
Tryp_SPc 42..244 CDD:214473 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.