DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG31220

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:272 Identity:63/272 - (23%)
Similarity:109/272 - (40%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEKNKLSPRITGGYRAKPYTIIYLVGIVY----AKSPLSSL-KFGAGTIISNQWILT-------- 68
            |.|.:.:.|:.||.........:|..::|    |.:|...| ....|::|:.:::||        
  Fly    95 CGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDT 159

  Fly    69 ---VKEVLIFKYIEAH------FGSK----RAFWGYDILRIYRENFY--FHYDKTRIIALVKCPY 118
               ::.|.:.::..:|      .|::    ......|:..|...|.|  .:|.....||||:.  
  Fly   160 VLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRL-- 222

  Fly   119 QKFDRRMSRVRVPAYGARFERYVGNMTM-VCGWG-----TDKRKVRLPTWMRCVEVEVMNNTECA 177
             |...|.:....|.....:.|.:....| |.|||     ....||     ::...|:|....||:
  Fly   223 -KEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKV-----LKHAAVKVRKPEECS 281

  Fly   178 KYHTPLKW---YEMCTSGEGFKGVCEGDMGGAVV-TMG---PNPTFIGIIWLMPTNC-SIGYPSV 234
            :.:....:   :::|..|...:|.|:||.|..:: |.|   ...||:..|......| :||:|||
  Fly   282 EKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSV 346

  Fly   235 HIRVSDHIKWIK 246
            ..|.:...|||:
  Fly   347 FTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 59/261 (23%)
Tryp_SPc 26..248 CDD:304450 60/263 (23%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 59/261 (23%)
Tryp_SPc 104..360 CDD:238113 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.