DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and sphinx1

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:253 Identity:209/253 - (82%)
Similarity:225/253 - (88%) Gaps:0/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVLSLTFSVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQW 65
            |||||.|||||||.||.|||||||||.||||||.:||||||||||.||..|||.:||||||||||
  Fly     1 MKLVVTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQW 65

  Fly    66 ILTVKEVLIFKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRV 130
            |||||.||.:.|||.|..|:|::.|:||:|||:|||.||||...:|||||||||||||||.||||
  Fly    66 ILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFDRRMDRVRV 130

  Fly   131 PAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGF 195
            |||..||||||||||||||:||:||..:||.||||:|||||||||||||:|||||||||||||||
  Fly   131 PAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGF 195

  Fly   196 KGVCEGDMGGAVVTMGPNPTFIGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHVSGVGF 253
            |||||||:|||||||||||||||||||||.|||||||||||||||||||||.||||||
  Fly   196 KGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIKRVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 179/219 (82%)
Tryp_SPc 26..248 CDD:304450 181/221 (82%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 179/219 (82%)
Tryp_SPc 26..248 CDD:304450 181/221 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470679
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.