DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG33461

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:310 Identity:63/310 - (20%)
Similarity:108/310 - (34%) Gaps:96/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVL--------SLTFSVCEKN-----KLSPRITGGYRAK----PYTIIYLVGIVYAKS 48
            ||.::|.|.|        |..|  .|:|     :||.:|..|..|:    |:       :.:..:
  Fly     6 MKTIIAYLALFVLGVHGSSSVF--LEENCGVVPRLSYKIINGTPARLGRYPW-------MAFLHT 61

  Fly    49 PLSSLKFGAGTIISNQWILTVKEVLIFKYIE--AHFGSK--------------RAFWGYDILRIY 97
            |...|  .||::| |||.:......|...:|  |..|..              .|...|::..::
  Fly    62 PTYFL--CAGSLI-NQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLF 123

  Fly    98 RENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVC-------------- 148
            :...|...|.:..|.::     :.:||:             .|..::..:|              
  Fly   124 KHRLYDPKDFSNDIGML-----RLERRV-------------EYTYHIQPICIFHHRRMQLVVDQI 170

  Fly   149 ------GWGTDKRKVRLPTWMRCVEVEVMN--NTECAK-YHTPLKWYEMCTSGEGFKGVCEGDMG 204
                  |||.....:...:....:|:.:..  ..:||: :.......::| :|.....:|.||.|
  Fly   171 TWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQIC-AGNDDGNLCRGDSG 234

  Fly   205 GA----VVTMGPNPTFI--GIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248
            |.    |:..|.. .|:  ||......|||  ..|:...|..:.:|||.|
  Fly   235 GPQGRYVLIFGMK-RFVQMGIASFTYENCS--KVSILTDVVRYGRWIKKV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 48/268 (18%)
Tryp_SPc 26..248 CDD:304450 51/270 (19%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 48/268 (18%)
Tryp_SPc 42..281 CDD:238113 51/270 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.