DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG30323

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:206 Identity:38/206 - (18%)
Similarity:66/206 - (32%) Gaps:79/206 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FGAGTIISNQWILTV--------------------KEVLIFKYIEAHFGSKRAFWGYDILRIYRE 99
            |.||:::|..|::|.                    ..|::|........|.:..  |.:.:|.  
  Fly    53 FCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNI--YHVQKIV-- 113

  Fly   100 NFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVG----NMTMVC---GWGTDKRKV 157
                 .|::.|....:....|.||.::       |.||...:.    |.|.:|   |||      
  Fly   114 -----LDESAISGCTELALLKLDRGVT-------GQRFAMMLPEKELNSTWLCNSLGWG------ 160

  Fly   158 RLPTWMRCVEVEVMNNTECAKYHTPLKWYE----------------------------MC-TSGE 193
            |: .::..|.:..|.......|..|:.|::                            :| ||..
  Fly   161 RI-YYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYT 224

  Fly   194 GFKGVCEGDMG 204
            |...:|:.|:|
  Fly   225 GRGNMCQQDLG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 38/206 (18%)
Tryp_SPc 26..248 CDD:304450 38/206 (18%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 38/206 (18%)
Tryp_SPc 45..272 CDD:214473 38/206 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.