DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG30286

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:86/219 - (39%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GTIISNQWILTV------KEVLIFKYIEAHFGSKRAF-----------WGYDILRIYRENFYFHY 105
            ||::::::|||.      .|.|..:..|  |.|..:.           ..::|...:|...|...
  Fly    62 GTLVNHRFILTAAHCIREDENLTVRLGE--FNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRT 124

  Fly   106 DKTRIIALVK----CPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPT----- 161
            ::...|.|::    ..|:...:.:..:.......:.||.  :..:..|||      |.|:     
  Fly   125 NRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERL--HRLVATGWG------RSPSEAANH 181

  Fly   162 WMRCVEVEVMNNTECAK-YHTPLKWYEMCTSGEGFKGV-CEGDMGGAV---VTMGPNPTFIGIIW 221
            .::.:.|..:|...|:| |....:..::|.|.|  .|| |.||.||.:   :.:.....|:.:..
  Fly   182 ILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHE--SGVSCSGDSGGPMGQAIRLDGRVLFVQVGI 244

  Fly   222 LMPTNCSIGYPSVHIRVSDHIKWI 245
            :...|.....|||...|.:||.||
  Fly   245 VSYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 46/217 (21%)
Tryp_SPc 26..248 CDD:304450 48/219 (22%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 48/219 (22%)
Tryp_SPc 39..268 CDD:214473 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.