DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG30098

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:259 Identity:53/259 - (20%)
Similarity:98/259 - (37%) Gaps:77/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RITGGYRAK--PYTIIYLVGIVYAKSPLSSLKFG-AGTIISNQWILT------VKEVLIFKYIEA 80
            |:.||..|:  |: :.||:         ...:|. .|::|:.:::||      :.:.|..:..| 
  Fly    36 RVIGGQNARRTPW-MAYLI---------RDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGE- 89

  Fly    81 HFGSKRAFWG----YDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGA------ 135
             :.|.|...|    |.::.|||...|..:....|..|      |.||::      .|.|      
  Fly    90 -YDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVL------KLDRQV------VYDAYIRPIC 141

  Fly   136 --------RFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAK------YHTPLKWY 186
                    .....:.|.|:. |||......::||.::.:.:..:.|..|..      ...|::: 
  Fly   142 ILLNSGLQSLANSIQNFTLT-GWGQMAHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQY- 204

  Fly   187 EMCTSGEGFKGVCEGDMG---GAVVTMGPNPTFI--GIIWLMPTNCSIGYPSVHIRVSDHIKWI 245
                       .|.||.|   |::|..|....::  |:...:..||. ||.| ::.:..::.|:
  Fly   205 -----------ACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCD-GYSS-YLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 52/257 (20%)
Tryp_SPc 26..248 CDD:304450 52/258 (20%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 52/256 (20%)
Tryp_SPc 37..258 CDD:238113 52/258 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.