DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG30090

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:284 Identity:49/284 - (17%)
Similarity:92/284 - (32%) Gaps:96/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NKLSPRITGG----YRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVK---------E 71
            |.::.:|.||    ..:.|:       :.|..|.:..:  ..||:|:.:::||..         :
  Fly    34 NTIAFKIIGGRDAIINSNPW-------MAYIHSSVKLI--CGGTLITQRFVLTAAHCVNEGSAVK 89

  Fly    72 VLIFKY----------------IEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQK 120
            |.:.:|                .|.|          |:...:|...:........|||::.    
  Fly    90 VRLGEYDDTATEDCNSKICIPRAEEH----------DVDMAFRHGKFSEIKNLNDIALLRL---- 140

  Fly   121 FDRRMSRVRVPAYGARFERYVGNMTMVC--------------------GWGTDKRKVRLPTWMRC 165
                          |:|..:..:::.:|                    ||| :.|..|....::.
  Fly   141 --------------AKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWG-ETRTHRTRGVLQI 190

  Fly   166 VEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTM-----GPNPTFIGIIWLMPT 225
            .:::..|:::|.:....|.......:|......|.||.||.:...     ...|...|::.....
  Fly   191 TQLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSR 255

  Fly   226 NCS-IGYPSVHIRVSDHIKWIKHV 248
            .|| ||   |:..|..:..||..|
  Fly   256 ECSGIG---VYTDVYSYADWIATV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 45/274 (16%)
Tryp_SPc 26..248 CDD:304450 47/276 (17%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 45/274 (16%)
Tryp_SPc 40..276 CDD:238113 47/276 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.