DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Klk1b3

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_032719.1 Gene:Klk1b3 / 18050 MGIID:97322 Length:261 Species:Mus musculus


Alignment Length:279 Identity:60/279 - (21%)
Similarity:106/279 - (37%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVALLVLSLTFSVCEKNKLSPRITGGYR----AKPYTII------YLVGIVYAKSPLSSLKF 55
            |..::..|.|||. .:.....:..||.||::    ::|:.:.      ||.|             
Mouse     1 MWFLILFLALSLG-GIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLCG------------- 51

  Fly    56 GAGTIISNQWILTVKEVLIFKYIEAHFGSKRAFW-----------------GYDILRIYRENFYF 103
              |.::...|:||........| :...|....|.                 |:::..:.:...:.
Mouse    52 --GVLLDPNWVLTAAHCYDDNY-KVWLGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMRKHIRFL 113

  Fly   104 HYDKTRIIALVKC--PYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGT-DKRKVRLPTWMRC 165
            .||.:..:.|::.  |....| .:..:.:|..    |..:|:..:..|||: ...|.:....:.|
Mouse   114 EYDYSNDLMLLRLSKPADITD-TVKPITLPTE----EPKLGSTCLASGWGSITPTKFQFTDDLYC 173

  Fly   166 VEVEVMNNTECAKYHTPLKWYEMCTSGE--GFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTNC- 227
            |.::::.|.:|||.|.......|..:||  |.|..|:||.||.::..|   ...||.....|.| 
Mouse   174 VNLKLLPNEDCAKAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDG---VLQGITSWGHTPCG 235

  Fly   228 SIGYPSVHIRVSDHIKWIK 246
            ....|.|:.:::....|||
Mouse   236 EPDMPGVYTKLNKFTSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 52/252 (21%)
Tryp_SPc 26..248 CDD:304450 54/254 (21%)
Klk1b3NP_032719.1 Tryp_SPc 25..256 CDD:238113 54/254 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.