DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and try-10

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:228 Identity:40/228 - (17%)
Similarity:84/228 - (36%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLSLTFSVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIIS----------- 62
            :|.|:|.     ..|..|..|:.|..:..:.|..:: .:.|..:.....|.:|:           
 Worm    63 ILLLSFI-----SYSTSIINGFSANSFDTLSLASVI-TRFPDGTTNVCGGVLIAPSIVITSAHCV 121

  Fly    63 ---NQWILTVKEVLIFKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFD-- 122
               :.:.:|.|..|...::..|...::.|..: .:.|.::.|....:....:|::..| |:.|  
 Worm   122 FSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSH-AMAISKKFFNDASEANDDVAVIFLP-QRADVC 184

  Fly   123 ---RRMSRVRVPAYGARFERYVGNMTM---------VCGWG-TDKRKVRLPTWMRCVEVEVMNNT 174
               ..:...::|:.|:...:....:|.         |.||| |:.:..:....:|    ::|.|.
 Worm   185 HSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGWGKTENKTAKYSDSVR----QMMVNL 245

  Fly   175 ECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAV 207
            ...:...  :.|.:..:..|....|.||.|..|
 Worm   246 SVRRIGK--RKYLIAKAVTGSSRACMGDSGSPV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 36/212 (17%)
Tryp_SPc 26..248 CDD:304450 36/211 (17%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 36/211 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.