DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CTRL

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:285 Identity:69/285 - (24%)
Similarity:110/285 - (38%) Gaps:68/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTFSV--------CEKNKLSP------RITGGYRAK----PYTIIYLVGIVYAKSPLSSL 53
            :|:||||.|:        |....:.|      ||..|..|.    |:.:        :....|..
Human     1 MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQV--------SLQDSSGF 57

  Fly    54 KFGAGTIISNQWILTVKEVLI-----FKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRI--- 110
            .|..|::||..|::|.....:     |..:..:..|..| ....:|.:.|...:..::.|.:   
Human    58 HFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNA-EPLQVLSVSRAITHPSWNSTTMNND 121

  Fly   111 IALVK--CPYQKFDRRMSRVRVPAYGARFERYVGNMTMV-CGWGTDKRKVRL-------PTWMRC 165
            :.|:|  .|.| :..|:|.|   ...:..|.....:|.| .|||      ||       |..::.
Human   122 VTLLKLASPAQ-YTTRISPV---CLASSNEALTEGLTCVTTGWG------RLSGVGNVTPAHLQQ 176

  Fly   166 VEVEVMNNTECAKYHTPLKWYE------MCTSGEGFKGVCEGDMGGAVVTMGPNP-TFIGIIWLM 223
            |.:.::...:|.:|     |..      :|..|.|... |:||.||.:|....|. ..|||:...
Human   177 VALPLVTVNQCRQY-----WGSSITDSMICAGGAGASS-CQGDSGGPLVCQKGNTWVLIGIVSWG 235

  Fly   224 PTNCSIGYPSVHIRVSDHIKWIKHV 248
            ..||::..|:|:.|||....||..|
Human   236 TKNCNVRAPAVYTRVSKFSTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 58/248 (23%)
Tryp_SPc 26..248 CDD:304450 59/250 (24%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.