DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG43336

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:306 Identity:65/306 - (21%)
Similarity:103/306 - (33%) Gaps:104/306 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTF-------------SVCEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFG-- 56
            ::|:.|||             ..|.....||.:.   |.|..|:..|     ..||..:....  
  Fly     3 VVVVGLTFFLLPLLGSTQFLDMACGIRAHSPSVP---RVKNGTVASL-----TSSPWMAFLHSTD 59

  Fly    57 -----AGTIISNQWILTVKEVLIFK-------------------------YIEA---------HF 82
                 .|::|:|:.:||.....:.:                         .|||         |:
  Fly    60 GRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHY 124

  Fly    83 GSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMV 147
            ......:...|||:||:..|  .|..|.|.:|..|                  |:.:|:.::..:
  Fly   125 NPMTMAYDIAILRLYRKVQY--TDNIRPICIVIDP------------------RWRKYIDSLDPL 169

  Fly   148 --CGWGT-----DKRKVRLPTWMRCVEVEVMNNTECAKYHT-PLKWYEMCTSGEGFKGVCEGDMG 204
              .|||.     |..|      :|.|::...:...|.:|.| .|...:.|...|. ..:|.||.|
  Fly   170 TGTGWGKTESEGDSAK------LRTVDLARKHPEVCRRYATLSLTANQFCAGNER-SNLCNGDSG 227

  Fly   205 ---GAVVTMGPNPTF--IGIIWLMPTNCSIGYPSVHIRVSDHIKWI 245
               ||::..|.:..|  :||.....|.|.:  .||...|..::.||
  Fly   228 GPVGALIPYGKSKRFVQVGIASFTNTQCVM--VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 56/273 (21%)
Tryp_SPc 26..248 CDD:304450 58/274 (21%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 56/267 (21%)
Tryp_SPc 40..271 CDD:238113 54/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.