DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and CG43110

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:260 Identity:58/260 - (22%)
Similarity:93/260 - (35%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CEKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLIFKYIEAH 81
            |.|..: |:|..|..|...:..|:.||......|.     .||||...::|||          ||
  Fly    28 CGKTPV-PKIISGSNASQQSAQYMAGIFNTTHLLC-----GGTIIHEDFVLTV----------AH 76

  Fly    82 FGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYV---GN 143
            ..|.:..:    :|:...|.....|:.|:|..:..|........:.:.:    .:.||.|   .|
  Fly    77 CKSTQTLF----VRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIAL----VKLERSVIFNLN 133

  Fly   144 MTMVC-----------------GWGTDKRKVRLPTWMRCVEVEVMNNTECAKY--HTPLKWYEMC 189
            :..:|                 |||..:...:.....| :.|...|...|..|  .:|.......
  Fly   134 IQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQR-IFVNRTNPMICHLYLGMSPDPKQICA 197

  Fly   190 TSGEGFKGVCEGDMGGAVVT----MGPN-PTFIGIIWLMPTNCS-IGYPSVHIRVSDHIKWIKHV 248
            |:.:|  ..|.||.||.:::    .|.| .|..||.......|: :|   ::..||.:..||.::
  Fly   198 TTDQG--DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVG---LYTDVSQYSGWIANI 257

  Fly   249  248
              Fly   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/247 (21%)
Tryp_SPc 26..248 CDD:304450 55/249 (22%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 53/247 (21%)
Tryp_SPc 36..257 CDD:238113 55/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.