DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Ctrl

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:305 Identity:64/305 - (20%)
Similarity:107/305 - (35%) Gaps:108/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTFSV--------CEKNKLSP------RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGA 57
            :|:||||.|:        |....::|      ||..|..|.|.:..:.|.:    ...:...|..
  Rat     1 MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL----QDNTGFHFCG 61

  Fly    58 GTIISNQWILTVKEVLIFKYIEAHF----GSKRAFWGYDILRIYRENFYFHYDKT------RIIA 112
            |::|:..|::|.          ||.    |......|             .||::      ::::
  Rat    62 GSLIAPNWVVTA----------AHCKVTPGRHFVILG-------------EYDRSSNAEPIQVLS 103

  Fly   113 LVKC--------PYQKFDRRMSRVRVPAYGARFERYVGNMTMVC-----------------GWGT 152
            :.|.        .....|..:.::..||      ||...::.||                 ||| 
  Rat   104 ISKAITHPSWNPNTMNNDLTLLKLASPA------RYTAQVSPVCLASSNEALPAGLTCVTTGWG- 161

  Fly   153 DKRKVRL-------PTWMRCVEVEVMNNTECAKYHTPLKWYE------MCTSGEGFKGVCEGDMG 204
                 |:       |..::.|.:.::...:|.:|     |..      :|..|.|... |:||.|
  Rat   162 -----RISGVGNVTPARLQQVVLPLVTVNQCRQY-----WGSRITDSMICAGGAGASS-CQGDSG 215

  Fly   205 GAVVTMGPNP-TFIGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248
            |.:|....|. ..|||:.....||::..|:::.|||....||..|
  Rat   216 GPLVCQKGNTWVLIGIVSWGTENCNVQAPAMYTRVSKFNTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/268 (20%)
Tryp_SPc 26..248 CDD:304450 54/270 (20%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 53/268 (20%)
Tryp_SPc 34..260 CDD:238113 54/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.