DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and Ctrl

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:292 Identity:65/292 - (22%)
Similarity:108/292 - (36%) Gaps:82/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTFSV--------CEKNKLSP------RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGA 57
            :|:||||.|:        |....::|      ||..|..|.|.:..:.|.:    ...:...|..
Mouse     1 MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL----QDNTGFHFCG 61

  Fly    58 GTIISNQWILTVKEVLI-----FKYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCP 117
            |::||..|::|.....:     |..:..:..|..| ....:|.|.|...:.:::...:       
Mouse    62 GSLISPNWVVTAAHCQVTPGRHFVVLGEYDRSSNA-EPVQVLSIARAITHPNWNANTM------- 118

  Fly   118 YQKFDRRMSRVRVPAYGARFERYVGNMTMVC-----------------GWGTDKRKVRL------ 159
              ..|..:.::..||      ||...::.||                 |||      |:      
Mouse   119 --NNDLTLLKLASPA------RYTAQVSPVCLASTNEALPSGLTCVTTGWG------RISGVGNV 169

  Fly   160 -PTWMRCVEVEVMNNTECAKYHTPLKW------YEMCTSGEGFKGVCEGDMGGAVVTMGPNP-TF 216
             |..::.|.:.::...:|.:|     |      ..:|..|.|... |:||.||.:|....|. ..
Mouse   170 TPARLQQVVLPLVTVNQCRQY-----WGARITDAMICAGGSGASS-CQGDSGGPLVCQKGNTWVL 228

  Fly   217 IGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248
            |||:.....||:|..|:::.|||....||..|
Mouse   229 IGIVSWGTKNCNIQAPAMYTRVSKFSTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 54/255 (21%)
Tryp_SPc 26..248 CDD:304450 55/257 (21%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 54/255 (21%)
Tryp_SPc 34..260 CDD:238113 55/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.