DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and cela1.2

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:300 Identity:61/300 - (20%)
Similarity:107/300 - (35%) Gaps:90/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVALLVLSLTFSVCEKNKL-----SPRITGGYRAKPYTIIYLVGIVYAKSPLSS-LKFGAGTII 61
            |.:.||.:..|.::.|...|     ..|:.||..|||::..:.:.:.|  |.|.: ..:.:||:|
Zfish     2 LRILLLSVLATLALAEPRYLKDIAIEERVVGGEIAKPHSWPWQISLQY--SDLGTYYYYCSGTLI 64

  Fly    62 SNQWI-------------------------------LTVKEVLIFKYIEAHFGSKRAFWGYDILR 95
            ...|:                               ::|.||    :|..::......:|||   
Zfish    65 RPGWVMVAAHCVEALRKWTVALGDHDIYTHEGPEQYISVSEV----FIHPNWNPNNVAFGYD--- 122

  Fly    96 IYRENFYFHYDKTRIIALVKCPYQKFDRRMSR----VRVPAYGARFERYVGNMTMVCGWGTDKRK 156
                           |||::.   ..|..:|.    ..:|:.|....  .|:...:.|||..:..
Zfish   123 ---------------IALLRL---SIDATLSSYVQVATLPSSGEILP--YGHTCYITGWGYTETG 167

  Fly   157 VRLPTWMRCVEVEVMNNTECAK---YHTPLKWYEMCTSGEGFKGVCEGDMG--------GAVVTM 210
            ..|...::...:.|::...|::   :.:.:|...:|..|......|.||.|        |..|..
Zfish   168 GSLSAQLKQAYMPVVDYETCSQKDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVH 232

  Fly   211 GPNPTFIGIIWLMPTNCSIGY--PSVHIRVSDHIKWIKHV 248
            |.. :|:.     |..|:. |  |:...|||.:|.||..:
Zfish   233 GVT-SFVS-----PEGCNT-YKKPTGFTRVSAYINWINQI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 53/268 (20%)
Tryp_SPc 26..248 CDD:304450 54/270 (20%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 53/268 (20%)
Tryp_SPc 30..265 CDD:238113 54/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.