DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and zgc:171592

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001104713.2 Gene:zgc:171592 / 100003031 ZFINID:ZDB-GENE-080220-23 Length:260 Species:Danio rerio


Alignment Length:222 Identity:47/222 - (21%)
Similarity:79/222 - (35%) Gaps:47/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SSLKFGAGTIISNQWILTVKEVLIFKYIEAH----FGSKRAFWG-YD------------ILRIYR 98
            :.:.|..|::|:..|:||.          ||    .|..|...| :|            :.::..
Zfish    52 NGVHFCGGSLINRNWVLTA----------AHCSVVVGYHRVVLGEHDRGSNAEPIQVKLVSKVVT 106

  Fly    99 ENFYFHYDKTRIIALVKCPYQ-KFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTW 162
            ...:........|||:|.... ....|:|.|.:.......:.  |......|||. ......|..
Zfish   107 HPLFSRTTLNNDIALLKLASPVTLTARVSPVCLAPSAINIQS--GTRCFTTGWGR-TASTSSPRI 168

  Fly   163 MRCVEVEVMNNTECAKYHTPLKWYE-------MCTSGEGFKGVCEGDMGGAVVTMGPNP-TFIG- 218
            ::...|.::::.:|.:.     |..       :|..|.| ...|.||.||.:|...... |.:| 
Zfish   169 LQQTSVPLVSHADCRQI-----WGRNRVTDAMICAGGSG-SSSCRGDSGGPLVCERSGVWTLVGS 227

  Fly   219 IIWLMPTNCSIGYPSVHIRVSDHIKWI 245
            :.|.:.| |:..:|.|:.|:|....||
Zfish   228 VSWGLDT-CNTRFPGVYARISQQRSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 45/220 (20%)
Tryp_SPc 26..248 CDD:304450 47/222 (21%)
zgc:171592NP_001104713.2 Tryp_SPc 31..256 CDD:238113 47/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.