DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and CDC42

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001034891.1 Gene:CDC42 / 998 HGNCID:1736 Length:191 Species:Homo sapiens


Alignment Length:193 Identity:131/193 - (67%)
Similarity:153/193 - (79%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65
            ||.|||||||||||||||||||||||.||.||:|||||||:..||:..:|..|||:|||||||||
Human     1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYD 65

  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLK 130
            ||||||||||||||:|||:|:|:|||||:.||.||:.||||..|.:||||::|||||..|||||.
Human    66 RLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLA 130

  Fly   131 DKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKR-HKCALL 192
            ..|..|||......:|:::.||||:|||||||||||.||||||.:.|.|  ..||: .:|.||
Human   131 KNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP--PEPKKSRRCVLL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 122/172 (71%)
CDC42NP_001034891.1 Cdc42 3..177 CDD:206664 122/173 (71%)
Effector region. /evidence=ECO:0000255 32..40 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.