DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and RHO3

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_012148.1 Gene:RHO3 / 854688 SGDID:S000001380 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:90/219 - (41%)
Similarity:121/219 - (55%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRP 69
            |.|::||||.|||.||..:|...||..|.||||:||..::.||:|.|.|.||||||||::||||.
Yeast    18 KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRS 82

  Fly    70 LSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKL 134
            |||..|...::|||:.:..|.|||:.||..|:..||..|.::||..|.|||:::.     :...:
Yeast    83 LSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNEN-----ESNAI 142

  Fly   135 TP--------------------------ITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAI 173
            ||                          |:|.:||||||:|.|::||||||...||:...|.||.
Yeast   143 TPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAA 207

  Fly   174 RSVLC--PV---VRGPKRHKCALL 192
            |..|.  ||   |:......|.::
Yeast   208 RVALTAGPVATEVKSDSGSSCTIM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 85/196 (43%)
RHO3NP_012148.1 Rho3 17..231 CDD:206706 90/217 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.