DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rac2 and Rhoq

DIOPT Version :9

Sequence 1:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_038934034.1 Gene:Rhoq / 85428 RGDID:621626 Length:355 Species:Rattus norvegicus


Alignment Length:142 Identity:81/142 - (57%)
Similarity:107/142 - (75%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVF 78
            |.:.|.: ||..:|||.||:|||||:|:.:|.|..|....||:|||||||||||||||||.||||
  Rat   210 VRRACFM-SYANDAFPEEYVPTVFDHYAVSVTVGGKQYLFGLYDTAGQEDYDRLRPLSYPMTDVF 273

  Fly    79 LICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGL 143
            |||||:||||||:||:.:|.||::.:.|:||.:|:||::|||||.:|:.:|.|.|..|:...||.
  Rat   274 LICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPVCVEQGQ 338

  Fly   144 AMAKEIAAVKYL 155
            .:||||.|..|:
  Rat   339 KLAKEIGACCYV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 81/142 (57%)
RhoqXP_038934034.1 P-loop_NTPase 210..350 CDD:422963 80/140 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X103
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.